PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_129360_qxwi.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 180aa    MW: 20241 Da    PI: 5.247
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_129360_qxwi.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.61e-113191363
                        XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                        +l++ +r+++NRe+ArrsR RK++ ++ L+    e++a+N +   + ++ ++++  +++e+
  Bv6_129360_qxwi.t1 31 DLRKRKRMESNRESARRSRIRKQKHMDDLRAQTIEIKAQNNKILTTTNSTTQHYLDVEAEN 91
                        58999***********************************999999999998888777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.7E-1022113No hitNo description
SMARTSM003386.8E-152993IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.5993194IPR004827Basic-leucine zipper domain
PfamPF001701.4E-83283IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.47E-103384No hitNo description
CDDcd147022.52E-163484No hitNo description
PROSITE patternPS0003603651IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MASSSSSSQQ HVITPNNSSS GSEADPQQMM DLRKRKRMES NRESARRSRI RKQKHMDDLR  60
AQTIEIKAQN NKILTTTNST TQHYLDVEAE NSVLRAQLAE LGNRLQSLNN IISCLTTTNT  120
NTNTNTNTNN NGNNNYNSEC DDQESFGSFD LEFDDGFSMN SWGFSFANYP IVSTSDAFMC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13253RKRKRMESNRESARRSRIRKQK
24552RRSRIRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010679785.11e-131PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0J8CBA81e-131A0A0J8CBA8_BETVU; Uncharacterized protein
STRINGSolyc01g109880.2.12e-44(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.11e-35basic leucine-zipper 44